SCOPe 2.06: Domain d3c3ua_: 3c3u A:

Lineage for d3c3ua_ (3c3u A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188399] (45 PDB entries)

8. Domain d3c3ua_: 3c3u A: [155923]
   automated match to d1j96a_
   complexed with c2u, nap, zn

Details for d3c3ua_

PDB Entry: 3c3u, 1.8 Å

PDB Description: Crystal structure of AKR1C1 in complex with NADP and 3,5-dichlorosalicylic acid

PDB Compounds: (A:) Aldo-keto reductase family 1 member C1

SCOPe Domain Sequences for d3c3ua_:

Sequence; same for both SEQRES and ATOM records:

>d3c3ua_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kyqcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeqvgl
airskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpvsvk
pgeevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkpglk
ykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlca
lakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnv
ryltldifagppnypfsdey

Timeline for d3c3ua_:

• d3c3ua_ first appeared in SCOP 1.75, called d3c3ua1
  
• d3c3ua_ appears in SCOPe 2.05
  
• d3c3ua_ appears in SCOPe 2.07
  
• d3c3ua_ appears in the current release, SCOPe 2.08