Lineage for d1gcwd_ (1gcw D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687130Species Houndshark (Mustelus griseus) [TaxId:89020] [46515] (2 PDB entries)
  8. 2687134Domain d1gcwd_: 1gcw D: [15592]
    Other proteins in same PDB: d1gcwa_, d1gcwc_
    complexed with cmo, hem

Details for d1gcwd_

PDB Entry: 1gcw (more details), 2 Å

PDB Description: CO form hemoglobin from mustelus griseus
PDB Compounds: (D:) protein (hemoglobin)

SCOPe Domain Sequences for d1gcwd_:

Sequence, based on SEQRES records: (download)

>d1gcwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
dkffevvidaisk

Sequence, based on observed residues (ATOM records): (download)

>d1gcwd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqfrssihagivvgalqda
vkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiwdkff
evvidaisk

SCOPe Domain Coordinates for d1gcwd_:

Click to download the PDB-style file with coordinates for d1gcwd_.
(The format of our PDB-style files is described here.)

Timeline for d1gcwd_: