![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54724] (35 PDB entries) |
![]() | Domain d3c3sb2: 3c3s B:84-196 [155918] Other proteins in same PDB: d3c3sa1, d3c3sb1 automated match to d1xila2 complexed with mn, so4 |
PDB Entry: 3c3s (more details), 2.5 Å
SCOPe Domain Sequences for d3c3sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c3sb2 d.44.1.1 (B:84-196) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]} ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq dplqgttglipllgidvwahayylqyknvrpdylkaiwnvinwenvterymac
Timeline for d3c3sb2: