Lineage for d3c3sa2 (3c3s A:84-196)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903585Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 1903711Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 1903775Species Human (Homo sapiens) [TaxId:9606] [54724] (26 PDB entries)
  8. 1903826Domain d3c3sa2: 3c3s A:84-196 [155916]
    Other proteins in same PDB: d3c3sa1, d3c3sb1
    automated match to d1xila2
    complexed with mn, so4

Details for d3c3sa2

PDB Entry: 3c3s (more details), 2.5 Å

PDB Description: role of a glutamate bridge spanning the dimeric interface of human manganese superoxide dismutase
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3c3sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3sa2 d.44.1.1 (A:84-196) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwahayylqyknvrpdylkaiwnvinwenvterymac

SCOPe Domain Coordinates for d3c3sa2:

Click to download the PDB-style file with coordinates for d3c3sa2.
(The format of our PDB-style files is described here.)

Timeline for d3c3sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c3sa1