Lineage for d1gcwb_ (1gcw B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 631651Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 631652Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 631691Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 632305Protein Hemoglobin, beta-chain [46500] (22 species)
  7. 632376Species Houndshark (Mustelus griseus) [TaxId:89020] [46515] (2 PDB entries)
  8. 632379Domain d1gcwb_: 1gcw B: [15591]
    Other proteins in same PDB: d1gcwa_, d1gcwc_

Details for d1gcwb_

PDB Entry: 1gcw (more details), 2 Å

PDB Description: CO form hemoglobin from mustelus griseus
PDB Compounds: (B:) protein (hemoglobin)

SCOP Domain Sequences for d1gcwb_:

Sequence, based on SEQRES records: (download)

>d1gcwb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
dkffevvidaisk

Sequence, based on observed residues (ATOM records): (download)

>d1gcwb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}
vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqfrssihagivvgalqda
vkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiwdkff
evvidaisk

SCOP Domain Coordinates for d1gcwb_:

Click to download the PDB-style file with coordinates for d1gcwb_.
(The format of our PDB-style files is described here.)

Timeline for d1gcwb_: