Lineage for d3c2wg1 (3c2w G:118-309)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870687Superfamily d.110.2: GAF domain-like [55781] (4 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 870688Family d.110.2.1: GAF domain [55782] (7 proteins)
  6. 870693Protein Bacteriophytochrome BphP [160661] (2 species)
  7. 870698Species Pseudomonas aeruginosa [TaxId:287] [160662] (1 PDB entry)
    Uniprot Q9HWR3 118-309
  8. 870705Domain d3c2wg1: 3c2w G:118-309 [155905]
    Other proteins in same PDB: d3c2wa2, d3c2wa3, d3c2wb2, d3c2wb3, d3c2wc2, d3c2wc3, d3c2wd2, d3c2wd3, d3c2we2, d3c2we3, d3c2wf2, d3c2wf3, d3c2wg2, d3c2wg3, d3c2wh2, d3c2wh3
    automatically matched to 3C2W A:118-309
    complexed with bla

Details for d3c2wg1

PDB Entry: 3c2w (more details), 2.9 Å

PDB Description: Crystal structure of the photosensory core domain of P. aeruginosa bacteriophytochrome PaBphP in the Pfr state
PDB Compounds: (G:) Bacteriophytochrome

SCOP Domain Sequences for d3c2wg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2wg1 d.110.2.1 (G:118-309) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg

SCOP Domain Coordinates for d3c2wg1:

Click to download the PDB-style file with coordinates for d3c2wg1.
(The format of our PDB-style files is described here.)

Timeline for d3c2wg1: