Lineage for d1gcvd_ (1gcv D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 324Species Houndshark (Mustelus griseus) [TaxId:89020] [46515] (2 PDB entries)
  8. 326Domain d1gcvd_: 1gcv D: [15590]
    Other proteins in same PDB: d1gcva_, d1gcvc_

Details for d1gcvd_

PDB Entry: 1gcv (more details), 2 Å

PDB Description: deoxy form hemoglobin from mustelus griseus

SCOP Domain Sequences for d1gcvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcvd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus)}
vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
dkffevvidaiskqyh

SCOP Domain Coordinates for d1gcvd_:

Click to download the PDB-style file with coordinates for d1gcvd_.
(The format of our PDB-style files is described here.)

Timeline for d1gcvd_: