![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Houndshark (Mustelus griseus) [TaxId:89020] [46515] (2 PDB entries) |
![]() | Domain d1gcvd_: 1gcv D: [15590] Other proteins in same PDB: d1gcva_, d1gcvc_ complexed with hem |
PDB Entry: 1gcv (more details), 2 Å
SCOPe Domain Sequences for d1gcvd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gcvd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]} vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw dkffevvidaiskqyh
Timeline for d1gcvd_: