SCOPe 2.03: Domain d1spgb_: 1spg B:

Lineage for d1spgb_ (1spg B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Fish (Leiostomus xanthurus) [TaxId:59837] [46514] (1 PDB entry)

8. Domain d1spgb_: 1spg B: [15588]
   Other proteins in same PDB: d1spga_
   complexed with cmo, hem

Details for d1spgb_

PDB Entry: 1spg, 1.95 Å

PDB Description: carbonmonoxy hemoglobin from the teleost fish leiostomus xanthurus

PDB Compounds: (B:) hemoglobin

SCOPe Domain Sequences for d1spgb_:

Sequence; same for both SEQRES and ATOM records:

>d1spgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Leiostomus xanthurus) [TaxId: 59837]}
vdwtdaeraaikalwgkidvgeigpqalsrllivypwtqrhfkgfgnistnaailgnakv
aehgktvmggldravqnmdniknvykqlsikhsekihvdpdnfrllgeiitmcvgakfgp
saftpeiheawqkflavvvsalgrqyh

Timeline for d1spgb_:

• d1spgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1spgb_ appears in SCOPe 2.02
  
• d1spgb_ appears in SCOPe 2.04
  
• d1spgb_ appears in the current release, SCOPe 2.08