Lineage for d1spgb_ (1spg B:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 208554Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 208555Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 208567Family a.1.1.2: Globins [46463] (18 proteins)
    Heme-binding protein
  6. 208921Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 209174Species Teleost fish (Leiostomus xanthurus) [46514] (1 PDB entry)
  8. 209175Domain d1spgb_: 1spg B: [15588]
    Other proteins in same PDB: d1spga_
    complexed with ace, cmo, hem

Details for d1spgb_

PDB Entry: 1spg (more details), 1.95 Å

PDB Description: carbonmonoxy hemoglobin from the teleost fish leiostomus xanthurus

SCOP Domain Sequences for d1spgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spgb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Teleost fish (Leiostomus xanthurus)}
vdwtdaeraaikalwgkidvgeigpqalsrllivypwtqrhfkgfgnistnaailgnakv
aehgktvmggldravqnmdniknvykqlsikhsekihvdpdnfrllgeiitmcvgakfgp
saftpeiheawqkflavvvsalgrqyh

SCOP Domain Coordinates for d1spgb_:

Click to download the PDB-style file with coordinates for d1spgb_.
(The format of our PDB-style files is described here.)

Timeline for d1spgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1spga_