SCOP 1.75: Domain d3c2la1: 3c2l A:10-91

Lineage for d3c2la1 (3c2l A:10-91)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (107 PDB entries)
   Uniprot P06746

8. Domain d3c2la1: 3c2l A:10-91 [155879]
   Other proteins in same PDB: d3c2la2, d3c2la3
   automatically matched to d1bpxa1
   complexed with f2a, mn, na

Details for d3c2la1

PDB Entry: 3c2l, 2.6 Å

PDB Description: ternary complex of dna polymerase beta with a c:dapcpp mismatch in the active site

PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d3c2la1:

Sequence; same for both SEQRES and ATOM records:

>d3c2la1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d3c2la1:

• d3c2la1 is new in SCOP 1.75
  
• d3c2la1 appears in SCOPe 2.01
  
• d3c2la1 appears in the current release, SCOPe 2.08