Lineage for d3c2ah1 (3c2a H:1-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287888Species Human (Homo sapiens), cluster 4 [TaxId:9606] [101505] (4 PDB entries)
  8. 1287891Domain d3c2ah1: 3c2a H:1-113 [155872]
    Other proteins in same PDB: d3c2ah2, d3c2ai2
    automatically matched to d1q1jh1

Details for d3c2ah1

PDB Entry: 3c2a (more details), 2.1 Å

PDB Description: antibody fab fragment 447-52d in complex with ug1033 peptide
PDB Compounds: (H:) Fab 447-52D, heavy chain

SCOPe Domain Sequences for d3c2ah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
wgkgttvtvss

SCOPe Domain Coordinates for d3c2ah1:

Click to download the PDB-style file with coordinates for d3c2ah1.
(The format of our PDB-style files is described here.)

Timeline for d3c2ah1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3c2ah2