SCOP 1.69: Domain d1t1nb_: 1t1n B:

Lineage for d1t1nb_ (1t1n B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (22 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (20 species)

7. Species Fish (Trematomus newnesi) [TaxId:35730] [46513] (2 PDB entries)

8. Domain d1t1nb_: 1t1n B: [15587]
   Other proteins in same PDB: d1t1na_

Details for d1t1nb_

PDB Entry: 1t1n, 2.2 Å

PDB Description: crystal structure of carbonmonoxy hemoglobin

SCOP Domain Sequences for d1t1nb_:

Sequence; same for both SEQRES and ATOM records:

>d1t1nb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Fish (Trematomus newnesi)}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh

Timeline for d1t1nb_:

• d1t1nb_ first appeared (with stable ids) in SCOP 1.55
  
• d1t1nb_ appears in SCOP 1.67
  
• d1t1nb_ appears in SCOP 1.71
  
• d1t1nb_ appears in the current release, SCOPe 2.08