| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries) |
| Domain d1t1nb_: 1t1n B: [15587] Other proteins in same PDB: d1t1na_ complexed with cmo, hem |
PDB Entry: 1t1n (more details), 2.2 Å
SCOPe Domain Sequences for d1t1nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t1nb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh
Timeline for d1t1nb_: