Lineage for d3c1vc_ (3c1v C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323269Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2323517Protein automated matches [190132] (4 species)
    not a true protein
  7. 2323520Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)
  8. 2323541Domain d3c1vc_: 3c1v C: [155869]
    automated match to d1m31a_
    complexed with ca

Details for d3c1vc_

PDB Entry: 3c1v (more details), 1.5 Å

PDB Description: the 1.5 a crystal structure of ca2+-bound s100a4
PDB Compounds: (C:) Protein S100-A4

SCOPe Domain Sequences for d3c1vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1vc_ a.39.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
ldsnrdnevdfqeycvflsciammcneffegfp

SCOPe Domain Coordinates for d3c1vc_:

Click to download the PDB-style file with coordinates for d3c1vc_.
(The format of our PDB-style files is described here.)

Timeline for d3c1vc_: