SCOP 1.75: Domain d3c1vb1: 3c1v B:2-94

Lineage for d3c1vb1 (3c1v B:2-94)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (4 PDB entries)
   MTS1 protein

8. Domain d3c1vb1: 3c1v B:2-94 [155868]
   automatically matched to d1m31a_
   complexed with ca

Details for d3c1vb1

PDB Entry: 3c1v, 1.5 Å

PDB Description: the 1.5 a crystal structure of ca2+-bound s100a4

PDB Compounds: (B:) Protein S100-A4

SCOP Domain Sequences for d3c1vb1:

Sequence; same for both SEQRES and ATOM records:

>d3c1vb1 a.39.1.2 (B:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
ldsnrdnevdfqeycvflsciammcneffegfp

Timeline for d3c1vb1:

• d3c1vb1 is new in SCOP 1.75
  
• d3c1vb1 is called d3c1vb_ in SCOPe 2.01
  
• d3c1vb1 appears in the current release, SCOPe 2.08, called d3c1vb_