SCOPe 2.04: Domain d3c1va_: 3c1v A:

Lineage for d3c1va_ (3c1v A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (33 PDB entries)

8. Domain d3c1va_: 3c1v A: [155867]
   automated match to d1m31a_
   complexed with ca

Details for d3c1va_

PDB Entry: 3c1v, 1.5 Å

PDB Description: the 1.5 a crystal structure of ca2+-bound s100a4

PDB Compounds: (A:) Protein S100-A4

SCOPe Domain Sequences for d3c1va_:

Sequence; same for both SEQRES and ATOM records:

>d3c1va_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
ldsnrdnevdfqeycvflsciammcneffegfp

Timeline for d3c1va_:

• d3c1va_ first appeared in SCOP 1.75, called d3c1va1
  
• d3c1va_ appears in SCOPe 2.03
  
• d3c1va_ appears in SCOPe 2.05
  
• d3c1va_ appears in the current release, SCOPe 2.08