| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (6 species) |
| Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [158385] (3 PDB entries) |
| Domain d3c1ch1: 3c1c H:1429-1520 [155864] Other proteins in same PDB: d3c1cb1, d3c1cc1, d3c1cf1, d3c1cg1 automatically matched to d1s32d_ protein/DNA complex |
PDB Entry: 3c1c (more details), 3.15 Å
SCOPe Domain Sequences for d3c1ch1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1ch1 a.22.1.1 (H:1429-1520) Histone H2B {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkyts
Timeline for d3c1ch1: