![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2A [47115] (7 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries) |
![]() | Domain d3c1cc1: 3c1c C:814-918 [155860] Other proteins in same PDB: d3c1cb1, d3c1cd1, d3c1cf1, d3c1ch1 automatically matched to d1aoic_ protein/DNA complex |
PDB Entry: 3c1c (more details), 3.15 Å
SCOPe Domain Sequences for d3c1cc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1cc1 a.22.1.1 (C:814-918) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]} aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
Timeline for d3c1cc1: