Lineage for d3c1cc1 (3c1c C:814-918)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698058Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries)
  8. 2698123Domain d3c1cc1: 3c1c C:814-918 [155860]
    Other proteins in same PDB: d3c1cb1, d3c1cd1, d3c1cf1, d3c1ch1
    automatically matched to d1aoic_
    protein/DNA complex

Details for d3c1cc1

PDB Entry: 3c1c (more details), 3.15 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
PDB Compounds: (C:) Histone H2A type 1

SCOPe Domain Sequences for d3c1cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1cc1 a.22.1.1 (C:814-918) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

SCOPe Domain Coordinates for d3c1cc1:

Click to download the PDB-style file with coordinates for d3c1cc1.
(The format of our PDB-style files is described here.)

Timeline for d3c1cc1: