Lineage for d1cg8b_ (1cg8 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 299Species Cartilaginous fish akaei (Dasyatis akajei) [TaxId:31902] [46512] (2 PDB entries)
  8. 301Domain d1cg8b_: 1cg8 B: [15586]
    Other proteins in same PDB: d1cg8a_

Details for d1cg8b_

PDB Entry: 1cg8 (more details), 1.9 Å

PDB Description: CO Form Hemoglobin from Dasyatis Akajei

SCOP Domain Sequences for d1cg8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg8b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei)}
vklsedqehyikgvwkdvdhkqitakalervfvvypwttrlfsklqglfsandigvqqha
dkvqralgeaiddlkkveinfqnlsgkhqeigvdtqnfkllgqtfmvelalhykktfrpk
ehaaaykffrlvaealssnyh

SCOP Domain Coordinates for d1cg8b_:

Click to download the PDB-style file with coordinates for d1cg8b_.
(The format of our PDB-style files is described here.)

Timeline for d1cg8b_: