SCOPe 2.06: Domain d3c1bd_: 3c1b D:

Lineage for d3c1bd_ (3c1b D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [158385] (2 PDB entries)

8. Domain d3c1bd_: 3c1b D: [155854]
   Other proteins in same PDB: d3c1ba_, d3c1bb_, d3c1bc_, d3c1be_, d3c1bf_, d3c1bg_
   automated match to d1kx5d_
   protein/DNA complex

Details for d3c1bd_

PDB Entry: 3c1b, 2.2 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure

PDB Compounds: (D:) Histone 2, H2bf

SCOPe Domain Sequences for d3c1bd_:

Sequence; same for both SEQRES and ATOM records:

>d3c1bd_ a.22.1.1 (D:) Histone H2B {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak

Timeline for d3c1bd_:

• d3c1bd_ first appeared in SCOP 1.75, called d3c1bd1
  
• d3c1bd_ appears in SCOPe 2.05
  
• d3c1bd_ appears in SCOPe 2.07
  
• d3c1bd_ appears in the current release, SCOPe 2.08