Class a: All alpha proteins [46456] (286 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (41 PDB entries) |
Domain d3c1bb_: 3c1b B: [155852] Other proteins in same PDB: d3c1ba_, d3c1bc_, d3c1bd_, d3c1be_, d3c1bg_, d3c1bh_ automated match to d1eqzd_ protein/DNA complex |
PDB Entry: 3c1b (more details), 2.2 Å
SCOPe Domain Sequences for d3c1bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1bb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} rdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvt amdvvyalkrqgrtlygfgg
Timeline for d3c1bb_: