![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Cartilaginous fish akaei (Dasyatis akajei) [TaxId:31902] [46512] (2 PDB entries) |
![]() | Domain d1cg5b_: 1cg5 B: [15585] Other proteins in same PDB: d1cg5a_ complexed with hem |
PDB Entry: 1cg5 (more details), 1.6 Å
SCOPe Domain Sequences for d1cg5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]} vklsedqehyikgvwkdvdhkqitakalervfvvypwttrlfsklqglfsandigvqqha dkvqralgeaiddlkkveinfqnlsgkhqeigvdtqnfkllgqtfmvelalhykktfrpk ehaaaykffrlvaealssnyh
Timeline for d1cg5b_: