Lineage for d3c0yb_ (3c0y B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115600Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 protein domains)
    automatically mapped to Pfam PF00850
  6. 2115607Protein Histone deacetylase 7, HDAC7 [159582] (1 species)
    HDAC7a
  7. 2115608Species Human (Homo sapiens) [TaxId:9606] [159583] (8 PDB entries)
    Uniprot Q8WUI4 515-900
  8. 2115622Domain d3c0yb_: 3c0y B: [155842]
    automated match to d3c0ya1
    complexed with k, zn

Details for d3c0yb_

PDB Entry: 3c0y (more details), 2.1 Å

PDB Description: Crystal structure of catalytic domain of human histone deacetylase HDAC7
PDB Compounds: (B:) Histone deacetylase 7a

SCOPe Domain Sequences for d3c0yb_:

Sequence, based on SEQRES records: (download)

>d3c0yb_ c.42.1.2 (B:) Histone deacetylase 7, HDAC7 {Human (Homo sapiens) [TaxId: 9606]}
pfttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkaslee
lqsvhserhvllygtnplsrlkldngklagllaqrmfvmlpcggvgvdtdtiwnelhssn
aarwaagsvtdlafkvasrelkngfavvrppghhadhstamgfcffnsvaiacrqlqqqs
kaskilivdwdvhhgngtqqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgegfn
vnvawaggldppmgdpeylaafrivvmpiarefspdlvlvsagfdaaeghpaplggyhvs
akcfgymtqqlmnlaggavvlalegghdltaicdaseacvaallgnrvdplseegwkqkp
nlnairsleavirvhskywgcmqrl

Sequence, based on observed residues (ATOM records): (download)

>d3c0yb_ c.42.1.2 (B:) Histone deacetylase 7, HDAC7 {Human (Homo sapiens) [TaxId: 9606]}
pfttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkaslee
lqsvhserhvllygtnplsvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvas
relkngfavvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngt
qqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpey
laafrivvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlagga
vvlalegghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhsky
wgcmqrl

SCOPe Domain Coordinates for d3c0yb_:

Click to download the PDB-style file with coordinates for d3c0yb_.
(The format of our PDB-style files is described here.)

Timeline for d3c0yb_: