Lineage for d1hbhd_ (1hbh D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300465Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300543Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)
  8. 2300554Domain d1hbhd_: 1hbh D: [15584]
    Other proteins in same PDB: d1hbha_, d1hbhc_
    complexed with hem

Details for d1hbhd_

PDB Entry: 1hbh (more details), 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect
PDB Compounds: (D:) hemoglobin (deoxy) (beta chain)

SCOPe Domain Sequences for d1hbhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbhd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d1hbhd_:

Click to download the PDB-style file with coordinates for d1hbhd_.
(The format of our PDB-style files is described here.)

Timeline for d1hbhd_: