SCOP 1.59: Domain d1hbhd_: 1hbh D:

Lineage for d1hbhd_ (1hbh D:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)

4. Superfamily a.1.1: Globin-like [46458] (3 families)

5. Family a.1.1.2: Globins [46463] (18 proteins)

6. Protein Hemoglobin, beta-chain [46500] (18 species)

7. Species Antarctic fish (Pagothenia bernacchii) [46511] (2 PDB entries)

8. Domain d1hbhd_: 1hbh D: [15584]
   Other proteins in same PDB: d1hbha_, d1hbhc_

Details for d1hbhd_

PDB Entry: 1hbh, 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

SCOP Domain Sequences for d1hbhd_:

Sequence; same for both SEQRES and ATOM records:

>d1hbhd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Antarctic fish (Pagothenia bernacchii)}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

Timeline for d1hbhd_:

• d1hbhd_ first appeared (with stable ids) in SCOP 1.55
  
• d1hbhd_ appears in SCOP 1.57
  
• d1hbhd_ appears in SCOP 1.61
  
• d1hbhd_ appears in the current release, SCOPe 2.08