SCOPe 2.07: Domain d3c0ob1: 3c0o B:2-84

Lineage for d3c0ob1 (3c0o B:2-84)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins)
   automatically mapped to Pfam PF03440

6. Protein Proaerolysin, N-terminal domain [56470] (1 species)

7. Species Aeromonas hydrophila [TaxId:644] [56471] (6 PDB entries)

8. Domain d3c0ob1: 3c0o B:2-84 [155837]
   Other proteins in same PDB: d3c0oa2, d3c0ob2
   automated match to d3c0na1
   complexed with act, m6p; mutant

Details for d3c0ob1

PDB Entry: 3c0o, 2.5 Å

PDB Description: crystal structure of the proaerolysin mutant y221g complexed with mannose-6-phosphate

PDB Compounds: (B:) Aerolysin

SCOPe Domain Sequences for d3c0ob1:

Sequence; same for both SEQRES and ATOM records:

>d3c0ob1 d.169.1.2 (B:2-84) Proaerolysin, N-terminal domain {Aeromonas hydrophila [TaxId: 644]}
epvypdqlrlfslgqgvcgdkyrpvnreeaqsvksnivgmmgqwqisglangwvimgpgy
ngeikpgtasntwcyptnpvtge

Timeline for d3c0ob1:

• d3c0ob1 first appeared in SCOP 1.75
  
• d3c0ob1 appears in SCOPe 2.06
  
• d3c0ob1 appears in the current release, SCOPe 2.08