![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (25 species) |
![]() | Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (9 PDB entries) |
![]() | Domain d1hbhb_: 1hbh B: [15583] Other proteins in same PDB: d1hbha_, d1hbhc_ complexed with hem |
PDB Entry: 1hbh (more details), 2.2 Å
SCOPe Domain Sequences for d1hbhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbhb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]} vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh aftaetqgafqkflavvvsalgkqyh
Timeline for d1hbhb_: