Lineage for d1hbhb_ (1hbh B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 436026Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 436027Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 436063Family a.1.1.2: Globins [46463] (22 proteins)
    Heme-binding protein
  6. 436496Protein Hemoglobin, beta-chain [46500] (20 species)
  7. 436534Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (4 PDB entries)
  8. 436537Domain d1hbhb_: 1hbh B: [15583]
    Other proteins in same PDB: d1hbha_, d1hbhc_

Details for d1hbhb_

PDB Entry: 1hbh (more details), 2.2 Å

PDB Description: structure of deoxyhaemoglobin of the antarctic fish pagothenia bernacchii and structural basis of the root effect

SCOP Domain Sequences for d1hbhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbhb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii)}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOP Domain Coordinates for d1hbhb_:

Click to download the PDB-style file with coordinates for d1hbhb_.
(The format of our PDB-style files is described here.)

Timeline for d1hbhb_: