SCOPe 2.05: Domain d3c0dd_: 3c0d D:

Lineage for d3c0dd_ (3c0d D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.3: NirD-like [158991] (1 protein)
   retains the common fold but lacks the Fe-S cluster
   automatically mapped to Pfam PF13806

6. Protein NADH-nitrite reductase small subunit NirD [158992] (3 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [158995] (1 PDB entry)
   Uniprot Q87HB1 4-111

8. Domain d3c0dd_: 3c0d D: [155822]
   automated match to d3c0da1

Details for d3c0dd_

PDB Entry: 3c0d, 2.4 Å

PDB Description: crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162

PDB Compounds: (D:) Putative nitrite reductase NADPH (Small subunit) oxidoreductase protein

SCOPe Domain Sequences for d3c0dd_:

Sequence; same for both SEQRES and ATOM records:

>d3c0dd_ b.33.1.3 (D:) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]}
ltkvklcqlddlmpfigatvliegervalfyipdsgvyavqdwdpigkayvmsrgivgdi
ngemcvasplykqhfslksgqcledeahclktwrvtvddnqvcyla

Timeline for d3c0dd_:

• d3c0dd_ first appeared in SCOP 1.75, called d3c0dd1
  
• d3c0dd_ appears in SCOPe 2.04
  
• d3c0dd_ appears in SCOPe 2.06
  
• d3c0dd_ appears in the current release, SCOPe 2.08