Lineage for d3c0dc_ (3c0d C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1783160Family b.33.1.3: NirD-like [158991] (1 protein)
    retains the common fold but lacks the Fe-S cluster
    automatically mapped to Pfam PF13806
  6. 1783161Protein NADH-nitrite reductase small subunit NirD [158992] (3 species)
  7. 1783166Species Vibrio parahaemolyticus [TaxId:670] [158995] (1 PDB entry)
    Uniprot Q87HB1 4-111
  8. 1783169Domain d3c0dc_: 3c0d C: [155821]
    automated match to d3c0da1

Details for d3c0dc_

PDB Entry: 3c0d (more details), 2.4 Å

PDB Description: crystal structure of the putative nitrite reductase nadph (small subunit) oxidoreductase protein q87hb1. northeast structural genomics consortium target vpr162
PDB Compounds: (C:) Putative nitrite reductase NADPH (Small subunit) oxidoreductase protein

SCOPe Domain Sequences for d3c0dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c0dc_ b.33.1.3 (C:) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]}
ltkvklcqlddlmpfigatvliegervalfyipdsgvyavqdwdpigkayvmsrgivgdi
ngemcvasplykqhfslksgqcledeahclktwrvtvddnqvcyla

SCOPe Domain Coordinates for d3c0dc_:

Click to download the PDB-style file with coordinates for d3c0dc_.
(The format of our PDB-style files is described here.)

Timeline for d3c0dc_: