| Class b: All beta proteins [48724] (180 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.3: NirD-like [158991] (1 protein) retains the common fold but lacks the Fe-S cluster automatically mapped to Pfam PF13806 |
| Protein NADH-nitrite reductase small subunit NirD [158992] (3 species) |
| Species Vibrio parahaemolyticus [TaxId:670] [158995] (1 PDB entry) Uniprot Q87HB1 4-111 |
| Domain d3c0dc_: 3c0d C: [155821] Other proteins in same PDB: d3c0da2 automated match to d3c0da1 |
PDB Entry: 3c0d (more details), 2.4 Å
SCOPe Domain Sequences for d3c0dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c0dc_ b.33.1.3 (C:) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]}
ltkvklcqlddlmpfigatvliegervalfyipdsgvyavqdwdpigkayvmsrgivgdi
ngemcvasplykqhfslksgqcledeahclktwrvtvddnqvcyla
Timeline for d3c0dc_: