Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (18 species) |
Species Antarctic fish (Pagothenia bernacchii) [46511] (2 PDB entries) |
Domain d1pbxb_: 1pbx B: [15582] Other proteins in same PDB: d1pbxa_ complexed with hem |
PDB Entry: 1pbx (more details), 2.5 Å
SCOP Domain Sequences for d1pbxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Pagothenia bernacchii)} vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh aftaetqgafqkflavvvsalgkqyh
Timeline for d1pbxb_: