Lineage for d1pbxb_ (1pbx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300453Species Emerald rockcod (Pagothenia bernacchii) [TaxId:40690] [46511] (12 PDB entries)
  8. 2300466Domain d1pbxb_: 1pbx B: [15582]
    Other proteins in same PDB: d1pbxa_
    complexed with cmo, hem

Details for d1pbxb_

PDB Entry: 1pbx (more details), 2.5 Å

PDB Description: haemoglobin of the antarctic fish pagothenia bernacchii: amino acid sequence, oxygen equilibria and crystal structure of its carbonmonoxy derivative
PDB Compounds: (B:) hemoglobin (carbonmonoxy) (beta chain)

SCOPe Domain Sequences for d1pbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Emerald rockcod (Pagothenia bernacchii) [TaxId: 40690]}
vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflavvvsalgkqyh

SCOPe Domain Coordinates for d1pbxb_:

Click to download the PDB-style file with coordinates for d1pbxb_.
(The format of our PDB-style files is described here.)

Timeline for d1pbxb_: