Lineage for d3c09d1 (3c09 D:312-480)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980294Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 980347Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 980401Family c.10.2.5: L domain [52071] (5 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 980402Protein EGF receptor extracellular domain [82326] (1 species)
  7. 980403Species Human (Homo sapiens) [TaxId:9606] [82327] (6 PDB entries)
  8. 980419Domain d3c09d1: 3c09 D:312-480 [155815]
    Other proteins in same PDB: d3c09a2, d3c09c1, d3c09c2, d3c09d2, d3c09h1, d3c09h2
    automatically matched to d1ivoa2
    complexed with bma, man, nag

Details for d3c09d1

PDB Entry: 3c09 (more details), 3.2 Å

PDB Description: crystal structure the fab fragment of matuzumab (fab72000) in complex with domain iii of the extracellular region of egfr
PDB Compounds: (D:) Epidermal growth factor receptor

SCOPe Domain Sequences for d3c09d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c09d1 c.10.2.5 (D:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke
isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOPe Domain Coordinates for d3c09d1:

Click to download the PDB-style file with coordinates for d3c09d1.
(The format of our PDB-style files is described here.)

Timeline for d3c09d1: