![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
![]() | Protein EGF receptor extracellular domain [82326] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries) |
![]() | Domain d3c09a1: 3c09 A:312-480 [155811] Other proteins in same PDB: d3c09a2, d3c09c1, d3c09c2, d3c09d2, d3c09h1, d3c09h2 automatically matched to d1ivoa2 complexed with bma, man, nag |
PDB Entry: 3c09 (more details), 3.2 Å
SCOPe Domain Sequences for d3c09a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c09a1 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
Timeline for d3c09a1: