SCOPe 2.06: Domain d3c08h2: 3c08 H:122-223

Lineage for d3c08h2 (3c08 H:122-223)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d3c08h2: 3c08 H:122-223 [155810]
   Other proteins in same PDB: d3c08h1, d3c08l1, d3c08l2
   automatically matched to d1ngzb2
   complexed with so4

Details for d3c08h2

PDB Entry: 3c08, 2.15 Å

PDB Description: crystal structure the fab fragment of matuzumab/emd72000 (fab72000)

PDB Compounds: (H:) Matuzumab Fab Heavy chain

SCOPe Domain Sequences for d3c08h2:

Sequence; same for both SEQRES and ATOM records:

>d3c08h2 b.1.1.2 (H:122-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Timeline for d3c08h2:

• d3c08h2 first appeared in SCOP 1.75
  
• d3c08h2 appears in SCOPe 2.05
  
• d3c08h2 appears in SCOPe 2.07
  
• d3c08h2 appears in the current release, SCOPe 2.08