| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46510] (2 PDB entries) |
| Domain d1ouud_: 1ouu D: [15581] Other proteins in same PDB: d1ouua_, d1ouuc_ complexed with cmo, hem |
PDB Entry: 1ouu (more details), 2.5 Å
SCOPe Domain Sequences for d1ouud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouud_ a.1.1.2 (D:) Hemoglobin, beta-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
sftpeiqatwqkfmkvvvaamgsryf
Timeline for d1ouud_: