Class a: All alpha proteins [46456] (289 folds) |
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) |
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
Protein Putative transcriptional regulator SCO4850 [158796] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [158797] (1 PDB entry) Uniprot Q9KZ96 90-235 |
Domain d3c07a2: 3c07 A:90-235 [155808] Other proteins in same PDB: d3c07a1, d3c07b1 complexed with so4 |
PDB Entry: 3c07 (more details), 2.7 Å
SCOPe Domain Sequences for d3c07a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c07a2 a.121.1.1 (A:90-235) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]} tdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseharveaigihrav lagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvvla rfrvlrplvrevhelftdflpgmtkv
Timeline for d3c07a2: