Lineage for d3c04a4 (3c04 A:369-463)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218284Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 1218285Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 1218309Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 1218310Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)
  8. 1218318Domain d3c04a4: 3c04 A:369-463 [155806]
    Other proteins in same PDB: d3c04a1, d3c04a2, d3c04a3
    automatically matched to d1k2yx4
    complexed with zn; mutant

Details for d3c04a4

PDB Entry: 3c04 (more details), 2.2 Å

PDB Description: structure of the p368g mutant of pmm/pgm from p. aeruginosa
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3c04a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c04a4 d.129.2.1 (A:369-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
sdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttpv
lvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d3c04a4:

Click to download the PDB-style file with coordinates for d3c04a4.
(The format of our PDB-style files is described here.)

Timeline for d3c04a4: