![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) ![]() contains a single copy of this fold and an extra beta-strand at the C-terminus |
![]() | Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
![]() | Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries) |
![]() | Domain d3c04a4: 3c04 A:369-463 [155806] Other proteins in same PDB: d3c04a1, d3c04a2, d3c04a3 automatically matched to d1k2yx4 complexed with zn; mutant |
PDB Entry: 3c04 (more details), 2.2 Å
SCOP Domain Sequences for d3c04a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c04a4 d.129.2.1 (A:369-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} sdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttpv lvlrfeadteeeleriktvfrnqlkavdsslpvpf
Timeline for d3c04a4: