Lineage for d3c04a3 (3c04 A:259-367)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517507Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2517508Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2517509Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 2517562Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 2517563Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)
  8. 2517584Domain d3c04a3: 3c04 A:259-367 [155805]
    Other proteins in same PDB: d3c04a4
    automated match to d1p5dx3
    complexed with zn; mutant

Details for d3c04a3

PDB Entry: 3c04 (more details), 2.2 Å

PDB Description: structure of the p368g mutant of pmm/pgm from p. aeruginosa
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d3c04a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c04a3 c.84.1.1 (A:259-367) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf

SCOPe Domain Coordinates for d3c04a3:

Click to download the PDB-style file with coordinates for d3c04a3.
(The format of our PDB-style files is described here.)

Timeline for d3c04a3: