![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
![]() | Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries) |
![]() | Domain d3c04a1: 3c04 A:6-154 [155803] Other proteins in same PDB: d3c04a4 automatically matched to d1k2yx1 complexed with zn; mutant |
PDB Entry: 3c04 (more details), 2.2 Å
SCOPe Domain Sequences for d3c04a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c04a1 c.84.1.1 (A:6-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} aptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelv kqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvaget laneqiqalreriekndlasgvgsveqvd
Timeline for d3c04a1: