Lineage for d3c04a1 (3c04 A:6-154)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845112Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 845113Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 845114Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 845167Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 845168Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)
  8. 845190Domain d3c04a1: 3c04 A:6-154 [155803]
    Other proteins in same PDB: d3c04a4
    automatically matched to d1k2yx1
    complexed with zn; mutant

Details for d3c04a1

PDB Entry: 3c04 (more details), 2.2 Å

PDB Description: structure of the p368g mutant of pmm/pgm from p. aeruginosa
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOP Domain Sequences for d3c04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c04a1 c.84.1.1 (A:6-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
aptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelv
kqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvaget
laneqiqalreriekndlasgvgsveqvd

SCOP Domain Coordinates for d3c04a1:

Click to download the PDB-style file with coordinates for d3c04a1.
(The format of our PDB-style files is described here.)

Timeline for d3c04a1: