SCOPe 2.06: Domain d1ouub_: 1ouu B:

Lineage for d1ouub_ (1ouu B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46510] (2 PDB entries)

8. Domain d1ouub_: 1ouu B: [15580]
   Other proteins in same PDB: d1ouua_, d1ouuc_
   complexed with cmo, hem

Details for d1ouub_

PDB Entry: 1ouu, 2.5 Å

PDB Description: carbonmonoxy trout hemoglobin i

PDB Compounds: (B:) hemoglobin I

SCOPe Domain Sequences for d1ouub_:

Sequence; same for both SEQRES and ATOM records:

>d1ouub_ a.1.1.2 (B:) Hemoglobin, beta-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
sftpeiqatwqkfmkvvvaamgsryf

Timeline for d1ouub_:

• d1ouub_ first appeared (with stable ids) in SCOP 1.55
  
• d1ouub_ appears in SCOPe 2.05
  
• d1ouub_ appears in SCOPe 2.07
  
• d1ouub_ appears in the current release, SCOPe 2.08