SCOPe 2.06: Domain d3bzwb_: 3bzw B:

Lineage for d3bzwb_ (3bzw B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.9: BT2961-like [159485] (3 proteins)
   PfamB PB005894;homotrimeric assembly

6. Protein Uncharacterized protein BT2961 [159486] (1 species)
   putative lipase

7. Species Bacteroides thetaiotaomicron [TaxId:818] [159487] (1 PDB entry)
   Uniprot Q8A3J3 38-285

8. Domain d3bzwb_: 3bzw B: [155793]
   automated match to d3bzwa1
   complexed with act, so4

Details for d3bzwb_

PDB Entry: 3bzw, 1.87 Å

PDB Description: crystal structure of a putative lipase from bacteroides thetaiotaomicron

PDB Compounds: (B:) Putative lipase

SCOPe Domain Sequences for d3bzwb_:

Sequence; same for both SEQRES and ATOM records:

>d3bzwb_ c.23.10.9 (B:) Uncharacterized protein BT2961 {Bacteroides thetaiotaomicron [TaxId: 818]}
iqhpwqgkkvgyigdsitdpncygdnikkywdflkewlgitpfvygisgrqwddvprqae
klkkehggevdailvfmgtndynssvpigewfteqeeqvlsahgemkkmvtrkkrtpvmt
qdtyrgrinigitqlkklfpdkqivlltplhrslanfgdknvqpdesyqngcgeyidayv
qaikeagniwgipvidfnavtgmnpmveeqliyfydagydrlhpdtkgqermartlmyql
lalpvaf

Timeline for d3bzwb_:

• d3bzwb_ first appeared in SCOP 1.75, called d3bzwb1
  
• d3bzwb_ appears in SCOPe 2.05
  
• d3bzwb_ appears in SCOPe 2.07
  
• d3bzwb_ appears in the current release, SCOPe 2.08