Lineage for d3bzub_ (3bzu B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 975436Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 975463Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 975479Species Human (Homo sapiens) [TaxId:9606] [117424] (19 PDB entries)
    Uniprot P28845
  8. 975505Domain d3bzub_: 3bzu B: [155789]
    automated match to d1xu9a_
    complexed with a21, nap

Details for d3bzub_

PDB Entry: 3bzu (more details), 2.25 Å

PDB Description: crystal structure of human 11-beta-hydroxysteroid dehydrogenase(hsd1) in complex with nadp and thiazolone inhibitor
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d3bzub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzub_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
plneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclel
gaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksme
vnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkey
svsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydss
lwttllirnpsrkileflysts

SCOPe Domain Coordinates for d3bzub_:

Click to download the PDB-style file with coordinates for d3bzub_.
(The format of our PDB-style files is described here.)

Timeline for d3bzub_: