Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries) Uniprot P28845 |
Domain d3bzua_: 3bzu A: [155788] Other proteins in same PDB: d3bzub3 automated match to d1xu9a_ complexed with a21, nap |
PDB Entry: 3bzu (more details), 2.25 Å
SCOPe Domain Sequences for d3bzua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzua_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} eefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelgaa sahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevnf lsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysvs rvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslwt tllirnpsrkileflystsynmd
Timeline for d3bzua_:
View in 3D Domains from other chains: (mouse over for more information) d3bzub2, d3bzub3, d3bzuc_, d3bzud_ |