SCOPe 2.05: Domain d3bzka5: 3bzk A:325-473

Lineage for d3bzka5 (3bzk A:325-473)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.13: Tex RuvX-like domain-like [159635] (1 protein)

6. Protein Transcriptional accessory factor Tex [159636] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [159637] (3 PDB entries)
   Uniprot Q9HTY8 325-473

8. Domain d3bzka5: 3bzk A:325-473 [155781]
   Other proteins in same PDB: d3bzka1, d3bzka2, d3bzka3, d3bzka4
   automated match to d3bzca5

Details for d3bzka5

PDB Entry: 3bzk, 2.3 Å

PDB Description: crystal structure of the tex protein from pseudomonas aeruginosa, crystal form 2

PDB Compounds: (A:) Tex

SCOPe Domain Sequences for d3bzka5:

Sequence; same for both SEQRES and ATOM records:

>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]}
pagpratlgldpglrtgvkvavvdatgklldtatvyphapknqwdqtlavlaalcakhqv
eliaigngtasretdklagelikkypgmkltkimvseagasvysaselaakefpeldvsl
rgavsiarrlqdplaelvkiepksigvgq

Timeline for d3bzka5:

• d3bzka5 first appeared in SCOP 1.75
  
• d3bzka5 appears in SCOPe 2.04
  
• d3bzka5 appears in SCOPe 2.06
  
• d3bzka5 appears in the current release, SCOPe 2.08