Lineage for d3bzka4 (3bzk A:637-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399760Protein Tex S1-domain [159106] (1 species)
  7. 2399761Species Pseudomonas aeruginosa [TaxId:287] [159107] (3 PDB entries)
    Uniprot Q9HTY8 637-730
  8. 2399762Domain d3bzka4: 3bzk A:637-730 [155780]
    Other proteins in same PDB: d3bzka1, d3bzka2, d3bzka3, d3bzka5
    automated match to d3bzca4

Details for d3bzka4

PDB Entry: 3bzk (more details), 2.3 Å

PDB Description: crystal structure of the tex protein from pseudomonas aeruginosa, crystal form 2
PDB Compounds: (A:) Tex

SCOPe Domain Sequences for d3bzka4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]}
fktaefqegveslkdlkpgmvlegvvtnvtnfgafvdigvhqdglvhisalsekfvkdpy
evvkagdivkvkvmevdiprnrvglsmrmsdtpg

SCOPe Domain Coordinates for d3bzka4:

Click to download the PDB-style file with coordinates for d3bzka4.
(The format of our PDB-style files is described here.)

Timeline for d3bzka4: