Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
Protein Tex S1-domain [159106] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [159107] (3 PDB entries) Uniprot Q9HTY8 637-730 |
Domain d3bzka4: 3bzk A:637-730 [155780] Other proteins in same PDB: d3bzka1, d3bzka2, d3bzka3, d3bzka5 automated match to d3bzca4 |
PDB Entry: 3bzk (more details), 2.3 Å
SCOPe Domain Sequences for d3bzka4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} fktaefqegveslkdlkpgmvlegvvtnvtnfgafvdigvhqdglvhisalsekfvkdpy evvkagdivkvkvmevdiprnrvglsmrmsdtpg
Timeline for d3bzka4:
View in 3D Domains from same chain: (mouse over for more information) d3bzka1, d3bzka2, d3bzka3, d3bzka5 |